General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6Q2YJ75",
        "id": "A0A6Q2YJ75_ESOLU",
        "source_organism": {
            "taxId": "8010",
            "scientificName": "Esox lucius",
            "fullName": "Esox lucius (Northern pike)"
        },
        "name": "Follistatin-related protein 1",
        "description": [
            "Secreted glycoprotein that is involved in various physiological processes, such as angiogenesis, regulation of the immune response, cell proliferation and differentiation. Plays a role in the development of the central nervous system, skeletal system, lungs, and ureter. Promotes endothelial cell survival, migration and differentiation into network structures in an AKT-dependent manner. Also promotes survival of cardiac myocytes. Initiates various signaling cascades by activating different receptors on the cell surface such as DIP2A, TLR4 or BMP receptors"
        ],
        "length": 310,
        "sequence": "MMLRTLPFLVLLVLALCQAEEVQSKSKVCANVFCGAGRECAVTEKGEPSCLCIESCKPHKRSVCGSNGKTYRNHCELHRDACLTGLKIQVAHDGHCQAKKAEQVAASPVVCYVADRNELRHRVIQWLQNEVVPDGWFVKGSNFTDILLKYFKNYDNGDSQLDSSELLKFIQHNDSNVDLQSYADQESNKLLSLCVDALIELSDENADWKLSFDEFLNCLKPGFNPPEKKCALEDETYDDGSETQVECNRCVCACGNWVCTAMTCTDKTALVEETGEAGQEMTEEEWGLRVAELNKHQETVEKMKVSTKEE",
        "proteome": "UP000265140",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005509",
                "name": "calcium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "74d40995f4506b494a617eb31c3cd0d8e3fda7bb",
        "counters": {
            "domain_architectures": 1227,
            "entries": 24,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 6,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "smart": 2,
                "pfam": 4,
                "ssf": 3,
                "profile": 2,
                "cdd": 2,
                "panther": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1227
        }
    }
}