General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6Q2WQE5",
        "id": "A0A6Q2WQE5_ESOLU",
        "source_organism": {
            "taxId": "8010",
            "scientificName": "Esox lucius",
            "fullName": "Esox lucius (Northern pike)"
        },
        "name": "DDB1- and CUL4-associated factor 12 beta-propeller domain-containing protein",
        "description": [
            "Substrate-recognition component of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex of the DesCEND (destruction via C-end degrons) pathway, which recognizes a C-degron located at the extreme C terminus of target proteins, leading to their ubiquitination and degradation. The C-degron recognized by the DesCEND pathway is usually a motif of less than ten residues and can be present in full-length proteins, truncated proteins or proteolytically cleaved forms. The DCX(DCAF12) complex specifically recognizes proteins with a diglutamate (Glu-Glu) at the C-terminus leading to their ubiquitination and degradation. Also directly recognizes the C-terminal glutamate-leucine (Glu-Leu) degron as an alternative degron in proteins leading to their ubiquitination and degradation"
        ],
        "length": 483,
        "sequence": "MARKPVSRKRKAGESKDQQQLGWCQSAHKRTRVSSSSRHAQQWWRSRLSVVCALRGREFRPQQQHEWRLQRSLRGFAAGRLPGILKEREFSLGRLNKVFASQWLNHRQVVCGTKCNTLFVADVLTGQITRIPMLKDGHGCGTGIGGTPGASFLPGSGSVSGLDQQGCGIHAIELNPSGTLLATGGDNPNSLAVYRLPTLDPVCVGDDGHKDWIFSIAWISDSMAVSGSRDGSMGLWEVSDEILSQAMKQQDEEGVPCYSHISHRALEDIPKEYTNPYNCKVRALAFNNNHKELGAVSLDGYFHLWKAEQNLSKLLSTKLPHCKENVCLAYGQDWSVYAVGSQAHVSFLDPRQPTHSIKSVSSRERGSEATRGIRSVSFYEHIVTVGTGQGSLLFYDIRAQRFLEDPSCPASGYRQRPGEGILKLTTGKGWLNHDETWRSYFSDINSFPNAVYTHCYDDSGTKLFVAGGPLCSGLHGNYAGLWS",
        "proteome": "UP000265140",
        "gene": "DCAF12",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e163c506677cb53726f73ce04eb94af0a297b973",
        "counters": {
            "domain_architectures": 1797,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "smart": 1,
                "profile": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1797
        }
    }
}