General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P9DNA7",
        "id": "A0A6P9DNA7_PANGU",
        "source_organism": {
            "taxId": "94885",
            "scientificName": "Pantherophis guttatus",
            "fullName": "Pantherophis guttatus (Corn snake)"
        },
        "name": "Phosphatidylethanolamine N-methyltransferase",
        "description": [
            "Catalyzes the three sequential steps of the methylation pathway for the biosynthesis of phosphatidylcholine, a critical and essential component for membrane structure. Uses S-adenosylmethionine (S-adenosyl-L-methionine, SAM or AdoMet) as the methyl group donor for the methylation of phosphatidylethanolamine (1,2-diacyl-sn-glycero-3-phosphoethanolamine, PE) to phosphatidylmonomethylethanolamine (1,2-diacyl-sn-glycero-3-phospho-N-methylethanolamine, PMME), PMME to phosphatidyldimethylethanolamine (1,2-diacyl-sn-glycero-3-phospho-N,N-dimethylethanolamine, PDME), and PDME to phosphatidylcholine (1,2-diacyl-sn-glycero-3-phosphocholine, PC), producing S-adenosyl-L-homocysteine in each step"
        ],
        "length": 219,
        "sequence": "MPLPLDCCGGLNNVDYSKVDLSAMTLLSDYVNVTDPNFIVAVISIAFNPLFWNVVARWEHRTRSLTRIFGSPYVACYFLGVVIILLNFLRTHCFGEAMKSQPKLPLLDCLLGYYASVTLIAVGILLVTSSFLALGFIGTFLGDYFGILMETKVTSFPFNVTENPMYWGSTSIYFGWSLMNASPVGLVLTVVVTLCYAVALLYEGPFTEEIYRNKAPKSK",
        "proteome": "UP001652622",
        "gene": "PEMT",
        "go_terms": [
            {
                "identifier": "GO:0008757",
                "name": "S-adenosylmethionine-dependent methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006656",
                "name": "phosphatidylcholine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1d9a6873267fbe30f852dd2ebe128eea30ccf9df",
        "counters": {
            "domain_architectures": 18289,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pirsf": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 18289
        }
    }
}