HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P8VT41",
"id": "A0A6P8VT41_GYMAC",
"source_organism": {
"taxId": "8218",
"scientificName": "Gymnodraco acuticeps",
"fullName": "Gymnodraco acuticeps (Antarctic dragonfish)"
},
"name": "Rho-related GTP-binding protein RhoG",
"description": [
"Plays a role in immunological synaptic F-actin density and architecture organization. Regulates actin reorganization in lymphocytes, possibly through the modulation of Rac1 activity. Required for the formation of membrane ruffles during macropinocytosis. Plays a role in cell migration and is required for the formation of cup-like structures during trans-endothelial migration of leukocytes. Binds phospholipids in an activation-dependent manner; thereby acting as an anchor for other proteins to the plasma membrane (PM). Plays a role in exocytosis of cytotoxic granules (CG) by lymphocytes/Component of the exocytosis machinery in natural killer (NK) and CD8+ T cells. Promotes the docking of cytotoxic granules (CG) to the plasma membrane through the interaction with UNC13D. Involved in the cytotoxic activity of lymphocytes/primary CD8+ T cells"
],
"length": 191,
"sequence": "MQTIKCVVVGDGAVGKTCLLISYTTNAFPEEYIPTVFDNYSAQMSVDGRTVSLNLWDTAGQEEYDRLRTLSYPQTNVFIICFSIGSPSSHANVRHKWHPEVSHHCPNVPIMLVGTKRDLRGDAETVKKLKEQGLAPTTQQQGNALAKQIGAVKYMECSALLQDGVREVFAEAVRAVLYPVTKKNPKKCVLL",
"proteome": "UP000515161",
"gene": "LOC117556949",
"go_terms": [
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003924",
"name": "GTPase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007264",
"name": "small GTPase-mediated signal transduction",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "31aa1b32c82271990f81b4779ae58d1cb9b14b00",
"counters": {
"domain_architectures": 273930,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ncbifam": 1,
"profile": 3,
"smart": 4,
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 273930
}
}
}
