"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6P8VT41"	"{'domain_architectures': 273930, 'entries': 17, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ncbifam': 1, 'profile': 3, 'smart': 4, 'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 273930}"	"['Plays a role in immunological synaptic F-actin density and architecture organization. Regulates actin reorganization in lymphocytes, possibly through the modulation of Rac1 activity. Required for the formation of membrane ruffles during macropinocytosis. Plays a role in cell migration and is required for the formation of cup-like structures during trans-endothelial migration of leukocytes. Binds phospholipids in an activation-dependent manner; thereby acting as an anchor for other proteins to the plasma membrane (PM). Plays a role in exocytosis of cytotoxic granules (CG) by lymphocytes/Component of the exocytosis machinery in natural killer (NK) and CD8+ T cells. Promotes the docking of cytotoxic granules (CG) to the plasma membrane through the interaction with UNC13D. Involved in the cytotoxic activity of lymphocytes/primary CD8+ T cells']"	"LOC117556949"	"[{'identifier': 'GO:0005525', 'name': 'GTP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003924', 'name': 'GTPase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0007264', 'name': 'small GTPase-mediated signal transduction', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A6P8VT41_GYMAC"	"31aa1b32c82271990f81b4779ae58d1cb9b14b00"	True	False	False	191	"Rho-related GTP-binding protein RhoG"	4	"UP000515161"	"MQTIKCVVVGDGAVGKTCLLISYTTNAFPEEYIPTVFDNYSAQMSVDGRTVSLNLWDTAGQEEYDRLRTLSYPQTNVFIICFSIGSPSSHANVRHKWHPEVSHHCPNVPIMLVGTKRDLRGDAETVKKLKEQGLAPTTQQQGNALAKQIGAVKYMECSALLQDGVREVFAEAVRAVLYPVTKKNPKKCVLL"	"unreviewed"	"{'taxId': '8218', 'scientificName': 'Gymnodraco acuticeps', 'fullName': 'Gymnodraco acuticeps (Antarctic dragonfish)'}"