HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P8TG12",
"id": "A0A6P8TG12_GYMAC",
"source_organism": {
"taxId": "8218",
"scientificName": "Gymnodraco acuticeps",
"fullName": "Gymnodraco acuticeps (Antarctic dragonfish)"
},
"name": "GMP reductase",
"description": [
"Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. Plays a role in modulating cellular differentiation"
],
"length": 346,
"sequence": "MPRVDSDIKLDFKDVLFRPKRSSLKSRSEVDLQRTFTFRNSKQTYTGIPIIAANMDTTGTFEMAQVLSKHTLFTAIHKHYSVEDWKNFAAKNPDCVEHVAASSGSGVADLERLCAILEAVPVIKYICLDVANGYSEYFVEFVKTVRERFPKHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRIKTGVGYPQLSAVIECADSAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMMGGMLAGHDQCTGEVIEKNGKKVKLFYGMSSDTAMKKYVGGVAEYRASEGRTVEVPYRGDVNNTILDVLGGLRSTCTYVGAAKLKELSRRTTFIRVTQQSSQMFLS",
"proteome": "UP000515161",
"gene": "gmpr",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003920",
"name": "GMP reductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009117",
"name": "nucleotide metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:1902560",
"name": "GMP reductase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a2d25702dedbe8e7de1a6960dc2307b5a08c8f60",
"counters": {
"domain_architectures": 17457,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"pirsf": 1,
"hamap": 1,
"ncbifam": 2,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17457
}
}
}