GET /api/protein/UniProt/A0A6P8NAC4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P8NAC4",
"id": "A0A6P8NAC4_GEOSA",
"source_organism": {
"taxId": "260995",
"scientificName": "Geotrypetes seraphini",
"fullName": "Geotrypetes seraphini (Gaboon caecilian)"
},
"name": "Regulator of G-protein signaling 8",
"description": [
"Regulates G protein-coupled receptor signaling cascades, including signaling downstream of the N-formylpeptide chemoattractant receptors and leukotriene receptors. Inhibits B cell chemotaxis. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form"
],
"length": 168,
"sequence": "MRTRLGCLSHKTDSCNDFTAILPDKPNRALKRLSTEEAAKWAHSFDLLLSNKYGLSAFQAFLKTEFSEENLEFWMACEEFKKTRSAAKLPAKAHRIYQEFIDVQAPREVNLDFQAREITKKNLQQPSLSCFDLAQVRVRSLMEKDSYPRFLRSKIYKDLLSHTQRRPS",
"proteome": "UP000515159",
"gene": "RGS8",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3962b823cbd84ba1c9ff3d7eb9ca5befd0245855",
"counters": {
"domain_architectures": 22883,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"pfam": 1,
"smart": 1,
"profile": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 22883
}
}
}