"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6P8NAC4"	"{'domain_architectures': 22883, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 2, 'pfam': 1, 'smart': 1, 'profile': 1, 'panther': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 22883}"	"['Regulates G protein-coupled receptor signaling cascades, including signaling downstream of the N-formylpeptide chemoattractant receptors and leukotriene receptors. Inhibits B cell chemotaxis. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form']"	"RGS8"	""	"A0A6P8NAC4_GEOSA"	"3962b823cbd84ba1c9ff3d7eb9ca5befd0245855"	True	False	False	168	"Regulator of G-protein signaling 8"	4	"UP000515159"	"MRTRLGCLSHKTDSCNDFTAILPDKPNRALKRLSTEEAAKWAHSFDLLLSNKYGLSAFQAFLKTEFSEENLEFWMACEEFKKTRSAAKLPAKAHRIYQEFIDVQAPREVNLDFQAREITKKNLQQPSLSCFDLAQVRVRSLMEKDSYPRFLRSKIYKDLLSHTQRRPS"	"unreviewed"	"{'taxId': '260995', 'scientificName': 'Geotrypetes seraphini', 'fullName': 'Geotrypetes seraphini (Gaboon caecilian)'}"