GET /api/protein/UniProt/A0A6P7RF84/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P7RF84",
        "id": "A0A6P7RF84_MUSCR",
        "source_organism": {
            "taxId": "10089",
            "scientificName": "Mus caroli",
            "fullName": "Mus caroli (Ryukyu mouse)"
        },
        "name": "FXYD domain-containing ion transport regulator",
        "description": [
            "Associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA) which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. Reduces the apparent affinity for external K(+), an effect that depends on the presence of external Na(+) and voltage. Increases the apparent affinity for intracellular Na(+)"
        ],
        "length": 84,
        "sequence": "MGFKVEADGSAARRVPEETDPFFYDYATVQTVGMTLATIMFVLGIIIILSKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV",
        "proteome": "UP000515126",
        "gene": "Fxyd7",
        "go_terms": [
            {
                "identifier": "GO:0099106",
                "name": "ion channel regulator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043269",
                "name": "regulation of monoatomic ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a6b0f0c4b2168d3a7a214e17be666e81b4d7355c",
        "counters": {
            "domain_architectures": 4100,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4100
        }
    }
}