"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6P7RF84"	"{'domain_architectures': 4100, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4100}"	"['Associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA) which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. Reduces the apparent affinity for external K(+), an effect that depends on the presence of external Na(+) and voltage. Increases the apparent affinity for intracellular Na(+)']"	"Fxyd7"	"[{'identifier': 'GO:0099106', 'name': 'ion channel regulator activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0043269', 'name': 'regulation of monoatomic ion transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A6P7RF84_MUSCR"	"a6b0f0c4b2168d3a7a214e17be666e81b4d7355c"	True	False	False	84	"FXYD domain-containing ion transport regulator"	3	"UP000515126"	"MGFKVEADGSAARRVPEETDPFFYDYATVQTVGMTLATIMFVLGIIIILSKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV"	"unreviewed"	"{'taxId': '10089', 'scientificName': 'Mus caroli', 'fullName': 'Mus caroli (Ryukyu mouse)'}"