General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P7MGS1",
        "id": "A0A6P7MGS1_BETSP",
        "source_organism": {
            "taxId": "158456",
            "scientificName": "Betta splendens",
            "fullName": "Betta splendens (Siamese fighting fish)"
        },
        "name": "Putative protein-lysine deacylase ABHD14B",
        "description": [
            "Acts as an atypical protein-lysine deacetylase in vitro. Catalyzes the deacetylation of lysine residues using CoA as substrate, generating acetyl-CoA and the free amine of protein-lysine residues. Additional experiments are however required to confirm the protein-lysine deacetylase activity in vivo. Has hydrolase activity towards various surrogate p-nitrophenyl (pNp) substrates, such as pNp-butyrate, pNp-acetate and pNp-octanoate in vitro, with a strong preference for pNp-acetate. May activate transcription"
        ],
        "length": 212,
        "sequence": "MMSAVETTEGSVQVRSCNAPLFYRQSRPAAGEARASVLLLHGIRFSSENWLSIGTLEALARAGCRAVAIDLPGLGRSKAAEAPAPVGEPAPAGFLKEVCEELGLSPVVVVSPSLSGMYSLPFLMQHQALVRGYVPVAPICTDRFTPEQYASVKVPALIVYGDQDTQLGEVSLRNLSNLPRHRVVVMRGAGHPCYLDDPDAWHAAVLDFLQTL",
        "proteome": "UP000515150",
        "gene": "abhd14b",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4208e7859dea7ff67287230d6f84ba11d78c698d",
        "counters": {
            "domain_architectures": 386493,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 386493
        }
    }
}