"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6P7MGS1"	"{'domain_architectures': 386493, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 386493}"	"['Acts as an atypical protein-lysine deacetylase in vitro. Catalyzes the deacetylation of lysine residues using CoA as substrate, generating acetyl-CoA and the free amine of protein-lysine residues. Additional experiments are however required to confirm the protein-lysine deacetylase activity in vivo. Has hydrolase activity towards various surrogate p-nitrophenyl (pNp) substrates, such as pNp-butyrate, pNp-acetate and pNp-octanoate in vitro, with a strong preference for pNp-acetate. May activate transcription']"	"abhd14b"	""	"A0A6P7MGS1_BETSP"	"4208e7859dea7ff67287230d6f84ba11d78c698d"	True	False	False	212	"Putative protein-lysine deacylase ABHD14B"	3	"UP000515150"	"MMSAVETTEGSVQVRSCNAPLFYRQSRPAAGEARASVLLLHGIRFSSENWLSIGTLEALARAGCRAVAIDLPGLGRSKAAEAPAPVGEPAPAGFLKEVCEELGLSPVVVVSPSLSGMYSLPFLMQHQALVRGYVPVAPICTDRFTPEQYASVKVPALIVYGDQDTQLGEVSLRNLSNLPRHRVVVMRGAGHPCYLDDPDAWHAAVLDFLQTL"	"unreviewed"	"{'taxId': '158456', 'scientificName': 'Betta splendens', 'fullName': 'Betta splendens (Siamese fighting fish)'}"