General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P7JDR4",
        "id": "A0A6P7JDR4_9TELE",
        "source_organism": {
            "taxId": "210632",
            "scientificName": "Parambassis ranga",
            "fullName": "Parambassis ranga (Indian glassy fish)"
        },
        "name": "Protein unc-119 homolog A",
        "description": [
            "Involved in synaptic functions in photoreceptor cells, the signal transduction in immune cells as a Src family kinase activator, endosome recycling, the uptake of bacteria and endocytosis, protein trafficking in sensory neurons and as lipid-binding chaperone with specificity for a diverse subset of myristoylated proteins. Specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Binds myristoylated GNAT1 and is required for G-protein localization and trafficking in sensory neurons. Probably plays a role in trafficking proteins in photoreceptor cells. Plays important roles in mediating Src family kinase signals for the completion of cytokinesis via RAB11A"
        ],
        "length": 205,
        "sequence": "MKVQQGCNSAGMGIPVTTEEELRKNAVISPEDVLGLQKITKNYLCSPEENVHMIDFTRFKIRDMETGTVLFEITKPPTPADGRTHCDPNAGRFVRYQFTPAFLQLRQVGATVEFTVGDSPINNFRMIERHYFRDQLLKSFDFEFGFCMPSSKNTCEHIYEFPALSEEIMREMILHPYETQSDSFYFVDNKLVMHNKADYSYSGGP",
        "proteome": "UP000515145",
        "gene": "unc119a1",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7acda34a98960d37aa044615579611afef0e6661",
        "counters": {
            "domain_architectures": 5103,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5103
        }
    }
}