"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6P7JDR4"	"{'domain_architectures': 5103, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'pfam': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5103}"	"['Involved in synaptic functions in photoreceptor cells, the signal transduction in immune cells as a Src family kinase activator, endosome recycling, the uptake of bacteria and endocytosis, protein trafficking in sensory neurons and as lipid-binding chaperone with specificity for a diverse subset of myristoylated proteins. Specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Binds myristoylated GNAT1 and is required for G-protein localization and trafficking in sensory neurons. Probably plays a role in trafficking proteins in photoreceptor cells. Plays important roles in mediating Src family kinase signals for the completion of cytokinesis via RAB11A']"	"unc119a1"	""	"A0A6P7JDR4_9TELE"	"7acda34a98960d37aa044615579611afef0e6661"	True	False	False	205	"Protein unc-119 homolog A"	3	"UP000515145"	"MKVQQGCNSAGMGIPVTTEEELRKNAVISPEDVLGLQKITKNYLCSPEENVHMIDFTRFKIRDMETGTVLFEITKPPTPADGRTHCDPNAGRFVRYQFTPAFLQLRQVGATVEFTVGDSPINNFRMIERHYFRDQLLKSFDFEFGFCMPSSKNTCEHIYEFPALSEEIMREMILHPYETQSDSFYFVDNKLVMHNKADYSYSGGP"	"unreviewed"	"{'taxId': '210632', 'scientificName': 'Parambassis ranga', 'fullName': 'Parambassis ranga (Indian glassy fish)'}"