GET /api/protein/UniProt/A0A6P6DM22/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P6DM22",
        "id": "A0A6P6DM22_OCTDE",
        "source_organism": {
            "taxId": "10160",
            "scientificName": "Octodon degus",
            "fullName": "Octodon degus (Degu)"
        },
        "name": "Protein BRICK1",
        "description": [
            "Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex. As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes"
        ],
        "length": 75,
        "sequence": "MAGQEDPVQREIHQDWANREYIELITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT",
        "proteome": "UP000515203",
        "gene": "Brk1",
        "go_terms": [
            {
                "identifier": "GO:0044877",
                "name": "protein-containing complex binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007015",
                "name": "actin filament organization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0031209",
                "name": "SCAR complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}