GET /api/protein/UniProt/A0A6P6DM22/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P6DM22",
"id": "A0A6P6DM22_OCTDE",
"source_organism": {
"taxId": "10160",
"scientificName": "Octodon degus",
"fullName": "Octodon degus (Degu)"
},
"name": "Protein BRICK1",
"description": [
"Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex. As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes"
],
"length": 75,
"sequence": "MAGQEDPVQREIHQDWANREYIELITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT",
"proteome": "UP000515203",
"gene": "Brk1",
"go_terms": [
{
"identifier": "GO:0044877",
"name": "protein-containing complex binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007015",
"name": "actin filament organization",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0031209",
"name": "SCAR complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1
}
}
}