"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6P6DM22"	"{'domain_architectures': 0, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1}"	"['Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex. As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes']"	"Brk1"	"[{'identifier': 'GO:0044877', 'name': 'protein-containing complex binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0007015', 'name': 'actin filament organization', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0031209', 'name': 'SCAR complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A6P6DM22_OCTDE"	""	True	False	False	75	"Protein BRICK1"	3	"UP000515203"	"MAGQEDPVQREIHQDWANREYIELITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT"	"unreviewed"	"{'taxId': '10160', 'scientificName': 'Octodon degus', 'fullName': 'Octodon degus (Degu)'}"