GET /api/protein/UniProt/A0A6P5QUR1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P5QUR1",
"id": "A0A6P5QUR1_MUSCR",
"source_organism": {
"taxId": "10089",
"scientificName": "Mus caroli",
"fullName": "Mus caroli (Ryukyu mouse)"
},
"name": "tRNA(His) guanylyltransferase",
"description": [
"Adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage. This step is essential for proper recognition of the tRNA and for the fidelity of protein synthesis. Also functions as a guanyl-nucleotide exchange factor/GEF for the MFN1 and MFN2 mitofusins thereby regulating mitochondrial fusion. By regulating both mitochondrial dynamics and bioenergetic function, it contributes to cell survival following oxidative stress"
],
"length": 298,
"sequence": "MWAFRTARIGSLLAATSVILRRCLRLGVAMAKSKFEYVRNFEVQDTCLPHCWVVVRLDGRNFHRFAEEHNFAKPNDSRALHLMTKCAQTVMEELEDIVIAYGQSDEYSFVFRKKSNWFKRRASKFMTLVASQFASSYVFYWRDYFEDQPLRYPPGFDGRVVLYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQQRLKGTLTADKNEILFSEFHINYNNEPHMYRKGTVLVWQKVEEVRTQEVRLPAEMEGEKKAVARTRTRVVALNCDLIGDAFWKEHPEILAEEN",
"proteome": "UP000515126",
"gene": "Thg1l",
"go_terms": [
{
"identifier": "GO:0000287",
"name": "magnesium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008193",
"name": "tRNA guanylyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006400",
"name": "tRNA modification",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b509ab2e6bff8d8efab83978307f20afe9e8f813",
"counters": {
"domain_architectures": 3975,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 2,
"pirsf": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3975
}
}
}