General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P4EN26",
        "id": "A0A6P4EN26_DRORH",
        "source_organism": {
            "taxId": "1041015",
            "scientificName": "Drosophila rhopaloa",
            "fullName": "Drosophila rhopaloa (Fruit fly)"
        },
        "name": "UPAR/Ly6 domain-containing protein qvr",
        "description": [
            "Bifunctional regulator of neuronal activity in the mushroom body, and possibly other regions of the brain, that acts as a signaling molecule required for homeostatic regulation of sleep under normal conditions and after sleep deprivation. Reduces neuronal excitability by enhancing Sh/shaker K(+) channel activity; possibly by stabilizing Sh/shaker to increase protein levels, accelerating its activation kinetics, slowing C-type inactivation and enhancing recovery from inactivation. Specifically affects the A-type K(+) current. Antagonizes nicotinic acetylcholine receptors (nAChRs) to reduce synaptic transmission, possibly by preventing their localization to the cell surface. Required for regulation of neuromuscular excitability and plasticity at neuromuscular junctions"
        ],
        "length": 155,
        "sequence": "MWTQRNAVGNWLLVLTVFLALAKFATTDNCFPTRSIYCYECDSWTDARCKDPFNYTALPRDQPPLMTCNGCCVKMVRHQRSPYEVVRRMCTSQLQINLFMVDHVCMMESSGNGHMCFCEEDMCNSSKDLLTNGCQLHLIPIAVAVSWLMGQLLSR",
        "proteome": "UP001652680",
        "gene": "LOC108044843",
        "go_terms": [
            {
                "identifier": "GO:0030431",
                "name": "sleep",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0032222",
                "name": "regulation of synaptic transmission, cholinergic",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:1903818",
                "name": "positive regulation of voltage-gated potassium channel activity",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0fc4b25e7d1b431d99e58c4f149d83ffaa95601d",
        "counters": {
            "domain_architectures": 6763,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6763
        }
    }
}