"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6P4EN26"	"{'domain_architectures': 5876, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5876}"	"['Bifunctional regulator of neuronal activity in the mushroom body, and possibly other regions of the brain, that acts as a signaling molecule required for homeostatic regulation of sleep under normal conditions and after sleep deprivation. Reduces neuronal excitability by enhancing Sh/shaker K(+) channel activity; possibly by stabilizing Sh/shaker to increase protein levels, accelerating its activation kinetics, slowing C-type inactivation and enhancing recovery from inactivation. Specifically affects the A-type K(+) current. Antagonizes nicotinic acetylcholine receptors (nAChRs) to reduce synaptic transmission, possibly by preventing their localization to the cell surface. Required for regulation of neuromuscular excitability and plasticity at neuromuscular junctions']"	"108044843"	"[{'identifier': 'GO:0030431', 'name': 'sleep', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0032222', 'name': 'regulation of synaptic transmission, cholinergic', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:1903818', 'name': 'positive regulation of voltage-gated potassium channel activity', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A6P4EN26_DRORH"	"0fc4b25e7d1b431d99e58c4f149d83ffaa95601d"	True	False	155	"UPAR/Ly6 domain-containing protein qvr"	3	"UP001652680"	"MWTQRNAVGNWLLVLTVFLALAKFATTDNCFPTRSIYCYECDSWTDARCKDPFNYTALPRDQPPLMTCNGCCVKMVRHQRSPYEVVRRMCTSQLQINLFMVDHVCMMESSGNGHMCFCEEDMCNSSKDLLTNGCQLHLIPIAVAVSWLMGQLLSR"	"unreviewed"	"{'taxId': '1041015', 'scientificName': 'Drosophila rhopaloa', 'fullName': 'Drosophila rhopaloa (Fruit fly)'}"