General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P3F701",
        "id": "A0A6P3F701_OCTDE",
        "source_organism": {
            "taxId": "10160",
            "scientificName": "Octodon degus",
            "fullName": "Octodon degus (Degu)"
        },
        "name": "Mitochondrial import inner membrane translocase subunit Tim21",
        "description": [
            "Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane",
            "Participates in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Also required for assembly of mitochondrial respiratory chain complex I and complex IV as component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex. Probably shuttles between the presequence translocase and respiratory-chain assembly intermediates in a process that promotes incorporation of early nuclear-encoded subunits into these complexes"
        ],
        "length": 247,
        "sequence": "MICTVLRAVQYAEKLHRSSGRRLLLPYFALNKAFFTTEPCLRRGLQVQKKKGRPGSIFEVTRKTVWTQGLRPQKADNRGKQVSAHSGQKGETAITTTQRVKEAGRDFTYVIVVLIGISITGGLFYAIFKELFSSSSPSMIYGKALEKCRTHPEVISFFGEPVRGYGEMTRRGRRHHVSFIDYVKDGLKHTRVKFYIEGSEPGKQGTVHVEVKENPNNGEYEFRYIFVEVESYPRRTIIIEDNRFRDN",
        "proteome": "UP000515203",
        "gene": "Timm21",
        "go_terms": [
            {
                "identifier": "GO:0030150",
                "name": "protein import into mitochondrial matrix",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005744",
                "name": "TIM23 mitochondrial import inner membrane translocase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "725247455a3d42ee2daa6346a53a13a92c0f7436",
        "counters": {
            "domain_architectures": 4032,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cathgene3d": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4032
        }
    }
}