"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6P3F701"	"{'domain_architectures': 3570, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3570}"	"['Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane', 'Participates in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Also required for assembly of mitochondrial respiratory chain complex I and complex IV as component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex. Probably shuttles between the presequence translocase and respiratory-chain assembly intermediates in a process that promotes incorporation of early nuclear-encoded subunits into these complexes']"	"Timm21"	"[{'identifier': 'GO:0030150', 'name': 'protein import into mitochondrial matrix', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005744', 'name': 'TIM23 mitochondrial import inner membrane translocase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A6P3F701_OCTDE"	"725247455a3d42ee2daa6346a53a13a92c0f7436"	True	False	247	"Mitochondrial import inner membrane translocase subunit Tim21"	3	"UP000515203"	"MICTVLRAVQYAEKLHRSSGRRLLLPYFALNKAFFTTEPCLRRGLQVQKKKGRPGSIFEVTRKTVWTQGLRPQKADNRGKQVSAHSGQKGETAITTTQRVKEAGRDFTYVIVVLIGISITGGLFYAIFKELFSSSSPSMIYGKALEKCRTHPEVISFFGEPVRGYGEMTRRGRRHHVSFIDYVKDGLKHTRVKFYIEGSEPGKQGTVHVEVKENPNNGEYEFRYIFVEVESYPRRTIIIEDNRFRDN"	"unreviewed"	"{'taxId': '10160', 'scientificName': 'Octodon degus', 'fullName': 'Octodon degus (Degu)'}"