General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J3PYK2",
        "id": "A0A6J3PYK2_TURTR",
        "source_organism": {
            "taxId": "9739",
            "scientificName": "Tursiops truncatus",
            "fullName": "Tursiops truncatus (Atlantic bottle-nosed dolphin)"
        },
        "name": "Kremen protein",
        "description": [
            "Receptor for Dickkopf proteins. Cooperates with DKK1/2 to inhibit Wnt/beta-catenin signaling by promoting the endocytosis of Wnt receptors LRP5 and LRP6. Plays a role in limb development; attenuates Wnt signaling in the developing limb to allow normal limb patterning and can also negatively regulate bone formation"
        ],
        "length": 461,
        "sequence": "MGTRAPQGLLLLLLLRLLLPRGTSAGSLHNPGLSECFQVNGADYRGHQNRTGPRGAGRPCLYWDQTQQHSYSSASDPHGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRPASATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSWALGPPGAALELTFRLFELADQRDQLELRDAASGSLLRAFDGTRPPPPGPLRLRSVALLLTFRSDARGHAQGFALTYRGLQDADDPAPPKGSAQTPAGPPDGANVSCSPRPGTPEAAIGAQVFLTVTAVSVLLLLLLSLLRLLRGRSCLLAPGKGPPALGPSRDPARSWAVWYRRPRGVALPCPPGDPQVESLTASYRPLSASSQSSLRSLISAL",
        "proteome": "UP000245320",
        "gene": "KREMEN2",
        "go_terms": [
            {
                "identifier": "GO:0016055",
                "name": "Wnt signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "39496a1f3456e516901af49df2e788367bc65be7",
        "counters": {
            "domain_architectures": 1001,
            "entries": 28,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "smart": 3,
                "cdd": 2,
                "profile": 3,
                "pfam": 3,
                "pirsf": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1001
        }
    }
}