GET /api/protein/UniProt/A0A6J3PYK2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J3PYK2",
"id": "A0A6J3PYK2_TURTR",
"source_organism": {
"taxId": "9739",
"scientificName": "Tursiops truncatus",
"fullName": "Tursiops truncatus (Atlantic bottle-nosed dolphin)"
},
"name": "Kremen protein",
"description": [
"Receptor for Dickkopf proteins. Cooperates with DKK1/2 to inhibit Wnt/beta-catenin signaling by promoting the endocytosis of Wnt receptors LRP5 and LRP6. Plays a role in limb development; attenuates Wnt signaling in the developing limb to allow normal limb patterning and can also negatively regulate bone formation"
],
"length": 461,
"sequence": "MGTRAPQGLLLLLLLRLLLPRGTSAGSLHNPGLSECFQVNGADYRGHQNRTGPRGAGRPCLYWDQTQQHSYSSASDPHGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRPASATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSWALGPPGAALELTFRLFELADQRDQLELRDAASGSLLRAFDGTRPPPPGPLRLRSVALLLTFRSDARGHAQGFALTYRGLQDADDPAPPKGSAQTPAGPPDGANVSCSPRPGTPEAAIGAQVFLTVTAVSVLLLLLLSLLRLLRGRSCLLAPGKGPPALGPSRDPARSWAVWYRRPRGVALPCPPGDPQVESLTASYRPLSASSQSSLRSLISAL",
"proteome": "UP000245320",
"gene": "KREMEN2",
"go_terms": [
{
"identifier": "GO:0016055",
"name": "Wnt signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "39496a1f3456e516901af49df2e788367bc65be7",
"counters": {
"domain_architectures": 1001,
"entries": 28,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"smart": 3,
"cdd": 2,
"profile": 3,
"pfam": 3,
"pirsf": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 9
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1001
}
}
}