GET /api/protein/UniProt/A0A6J3EQS7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J3EQS7",
        "id": "A0A6J3EQS7_AYTFU",
        "source_organism": {
            "taxId": "219594",
            "scientificName": "Aythya fuligula",
            "fullName": "Aythya fuligula (Tufted duck)"
        },
        "name": "Sodium/potassium-transporting ATPase subunit beta",
        "description": [
            "The beta subunit of the gastric H(+)/K(+) ATPase pump which transports H(+) ions in exchange for K(+) ions across the apical membrane of parietal cells. Plays a structural and regulatory role in the assembly and membrane targeting of a functionally active pump. Within a transport cycle, the transfer of a H(+) ion across the membrane is coupled to ATP hydrolysis and is associated with a transient phosphorylation of the alpha subunit that shifts the pump conformation from inward-facing (E1) to outward-facing state (E2). Interacts with the phosphorylation domain of the alpha subunit and functions as a ratchet, stabilizing the lumenal-open E2 conformation and preventing the reverse reaction of the transport cycle",
            "This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane"
        ],
        "length": 288,
        "sequence": "MATLNEKKTCSERMENFRRFVWNPETKLFMGRTLINWVWISLYYLAFYVVMTGLFALSIYSLMRTVNPYEPDYQDQLKSPGVTLRPDVYGDRGLQIYYNTSENKTWERLVTTLQTFLTAYTPAAQHLNINCTGDKYFIQDTFDGPNNTKLSCKFTSDMLQNCSGITDPTFGFPEGKPCFIIKMNRIIKFYPGNGTAPRVDCTYVGDESRPLEVDYYPANGTFNLHYFPYYGKKAQPTYSNPLVAVKFLNLTRNVELKIVCKIIGAGITFDNVHDPYEGKVEFKLKIED",
        "proteome": "UP000504639",
        "gene": "ATP4B",
        "go_terms": [
            {
                "identifier": "GO:0006813",
                "name": "potassium ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006814",
                "name": "sodium ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005890",
                "name": "sodium:potassium-exchanging ATPase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "edc17df419148265b8eea0f3941c45befc5b4f1c",
        "counters": {
            "domain_architectures": 7935,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ncbifam": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 2,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7935
        }
    }
}