GET /api/protein/UniProt/A0A6J3CSS6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J3CSS6",
        "id": "A0A6J3CSS6_AYTFU",
        "source_organism": {
            "taxId": "219594",
            "scientificName": "Aythya fuligula",
            "fullName": "Aythya fuligula (Tufted duck)"
        },
        "name": "General transcription and DNA repair factor IIH subunit TFB5",
        "description": [
            "In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape"
        ],
        "length": 71,
        "sequence": "MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDLDETHVFVLAELVNFLQERVGELMDQNSFPITQK",
        "proteome": "UP000504639",
        "gene": "GTF2H5",
        "go_terms": [
            {
                "identifier": "GO:0006289",
                "name": "nucleotide-excision repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006367",
                "name": "transcription initiation at RNA polymerase II promoter",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000439",
                "name": "transcription factor TFIIH core complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "178cb7c84e71b5a779d05632e12160bcd8707d09",
        "counters": {
            "domain_architectures": 3136,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3136
        }
    }
}