"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6J3CSS6"	"{'domain_architectures': 3136, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3136}"	"['In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape']"	"GTF2H5"	"[{'identifier': 'GO:0006289', 'name': 'nucleotide-excision repair', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006367', 'name': 'transcription initiation at RNA polymerase II promoter', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0000439', 'name': 'transcription factor TFIIH core complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A6J3CSS6_AYTFU"	"178cb7c84e71b5a779d05632e12160bcd8707d09"	True	False	False	71	"General transcription and DNA repair factor IIH subunit TFB5"	3	"UP000504639"	"MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDLDETHVFVLAELVNFLQERVGELMDQNSFPITQK"	"unreviewed"	"{'taxId': '219594', 'scientificName': 'Aythya fuligula', 'fullName': 'Aythya fuligula (Tufted duck)'}"