GET /api/protein/UniProt/A0A6J3CS20/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J3CS20",
"id": "A0A6J3CS20_AYTFU",
"source_organism": {
"taxId": "219594",
"scientificName": "Aythya fuligula",
"fullName": "Aythya fuligula (Tufted duck)"
},
"name": "peptidylprolyl isomerase",
"description": [
"Has the potential to contribute to the immunosuppressive and toxic effects of FK506 and rapamycin. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides"
],
"length": 108,
"sequence": "MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFRFKIGRQEVIKGFEEGVTQMSLGQRAKLTCTPEMAYGATGHPGVIPPNATLLFDVELLRLE",
"proteome": "UP000504639",
"gene": "FKBP1B",
"go_terms": [
{
"identifier": "GO:0003755",
"name": "peptidyl-prolyl cis-trans isomerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "597ff609af148c6a7b237ac50dda1c5478f47b0c",
"counters": {
"domain_architectures": 62513,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"profile": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 62513
}
}
}