"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6J3CS20"	"{'domain_architectures': 62513, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'profile': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 62513}"	"['Has the potential to contribute to the immunosuppressive and toxic effects of FK506 and rapamycin. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides']"	"FKBP1B"	"[{'identifier': 'GO:0003755', 'name': 'peptidyl-prolyl cis-trans isomerase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A6J3CS20_AYTFU"	"597ff609af148c6a7b237ac50dda1c5478f47b0c"	True	False	False	108	"peptidylprolyl isomerase"	3	"UP000504639"	"MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFRFKIGRQEVIKGFEEGVTQMSLGQRAKLTCTPEMAYGATGHPGVIPPNATLLFDVELLRLE"	"unreviewed"	"{'taxId': '219594', 'scientificName': 'Aythya fuligula', 'fullName': 'Aythya fuligula (Tufted duck)'}"
