General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J2PZ72",
        "id": "A0A6J2PZ72_COTGO",
        "source_organism": {
            "taxId": "56716",
            "scientificName": "Cottoperca gobio",
            "fullName": "Cottoperca gobio (Frogmouth)"
        },
        "name": "OTU domain-containing protein 3",
        "description": [
            "Deubiquitinating enzyme that hydrolyzes 'Lys-6'- and 'Lys-11'-linked polyubiquitin. Also hydrolyzes heterotypic (mixed and branched) and homotypic chains. Important regulator of energy metabolism. Glucose and fatty acids trigger its nuclear translocation by CBP-dependent acetylation. In the nucleus, deubiquitinates and stabilizes the nuclear receptor PPARD regulating the expression of various genes involved in glucose and lipid metabolism and oxidative phosphorylation. Also acts as a negative regulator of the ribosome quality control (RQC) by mediating deubiquitination of 40S ribosomal proteins RPS10/eS10 and RPS20/uS10, thereby antagonizing ZNF598-mediated 40S ubiquitination"
        ],
        "length": 358,
        "sequence": "MSRKQTPKPVRSNKKSELERKRDERAARRAIVKDRKNRPQDGDEGAEFVSFSNQLQALGLRLREVPGDGNCLFRALGDQLEGQSRGHLRLRQETVQYMMSHRQDFEPFVEDDVPFAQHLSNLSQPGTFAGNDAIVAFARSQQVKVVIHQLNAPLWEINGAEKQVCRELHIAYRYGDHYDSVRRTGDNSESPAQLRIENLQNSQGHQREFGDGQRDRRKNPSPTTSEEDNVILSSIKNRGIQGDEENLLQLSAATINAEWLVGSVLGQSCQGQCASGSCSACRAAATDYSEHKQSTEGSNIQKPKVSNKQRKDQQRLEKKKRQEDRHRQKFLQSKGSQDQNQNLPEAVTLVPALNTLSI",
        "proteome": "UP000504630",
        "gene": "otud3",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0385c19cd1efb2670ef9513f5d43d80283d20182",
        "counters": {
            "domain_architectures": 22191,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 22191
        }
    }
}