HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J2MPJ1",
"id": "A0A6J2MPJ1_9CHIR",
"source_organism": {
"taxId": "89673",
"scientificName": "Phyllostomus discolor",
"fullName": "Phyllostomus discolor (pale spear-nosed bat)"
},
"name": "Adenylyltransferase and sulfurtransferase MOCS3",
"description": [
"Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers URM1 and MOCS2A. Its N-terminus first activates URM1 and MOCS2A as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 and MOCS2A to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1 and MOCS2A. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; NFS1 probably acting as a sulfur donor for thiocarboxylation reactions"
],
"length": 458,
"sequence": "MAAKAEVRALQAEVARREKELSSLKQRLAAALLAEEEPERPAPVSPLPPKAALTREEILRYSRQLVLPELGVQGQLRLTAASVLVVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLPRQVLHGEALAGQAKVFSAAASLRSLNSAVECVPYAQALTPATALDLVRRYDVVADCSDNAPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCVFPQPPPADTVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGQLMLFDALRGRFRCIRLRSRRPDCAACGEQPTVTDLQDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGSPHVLLDVRPQVEVDICRLPHALHIPLKQLERRDAESLRLLGEAIQKGKRGTQEGAALPIYVICKLGNESQKAVKILQTLMAVQELGSLTVQDVVGGLMAWAAKIDGTFPQY",
"proteome": "UP000504628",
"gene": "MOCS3",
"go_terms": [
{
"identifier": "GO:0008641",
"name": "ubiquitin-like modifier activating enzyme activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016783",
"name": "sulfurtransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0070566",
"name": "adenylyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0002143",
"name": "tRNA wobble position uridine thiolation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005829",
"name": "cytosol",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "39f3ddf73e07cf4ac3a637cab78a1f5722c60329",
"counters": {
"domain_architectures": 10368,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"cdd": 2,
"pfam": 2,
"smart": 1,
"profile": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 10368
}
}
}