GET /api/protein/UniProt/A0A6J2MPJ1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6J2MPJ1",
        "id": "A0A6J2MPJ1_9CHIR",
        "source_organism": {
            "taxId": "89673",
            "scientificName": "Phyllostomus discolor",
            "fullName": "Phyllostomus discolor (pale spear-nosed bat)"
        },
        "name": "Adenylyltransferase and sulfurtransferase MOCS3",
        "description": [
            "Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers URM1 and MOCS2A. Its N-terminus first activates URM1 and MOCS2A as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 and MOCS2A to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1 and MOCS2A. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; NFS1 probably acting as a sulfur donor for thiocarboxylation reactions"
        ],
        "length": 458,
        "sequence": "MAAKAEVRALQAEVARREKELSSLKQRLAAALLAEEEPERPAPVSPLPPKAALTREEILRYSRQLVLPELGVQGQLRLTAASVLVVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLPRQVLHGEALAGQAKVFSAAASLRSLNSAVECVPYAQALTPATALDLVRRYDVVADCSDNAPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCVFPQPPPADTVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGQLMLFDALRGRFRCIRLRSRRPDCAACGEQPTVTDLQDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGSPHVLLDVRPQVEVDICRLPHALHIPLKQLERRDAESLRLLGEAIQKGKRGTQEGAALPIYVICKLGNESQKAVKILQTLMAVQELGSLTVQDVVGGLMAWAAKIDGTFPQY",
        "proteome": "UP000504628",
        "gene": "MOCS3",
        "go_terms": [
            {
                "identifier": "GO:0008641",
                "name": "ubiquitin-like modifier activating enzyme activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016783",
                "name": "sulfurtransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0070566",
                "name": "adenylyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0002143",
                "name": "tRNA wobble position uridine thiolation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005829",
                "name": "cytosol",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "39f3ddf73e07cf4ac3a637cab78a1f5722c60329",
        "counters": {
            "domain_architectures": 10368,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "cdd": 2,
                "pfam": 2,
                "smart": 1,
                "profile": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10368
        }
    }
}