"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6J2MPJ1"	"{'domain_architectures': 10368, 'entries': 18, 'isoforms': 0, 'proteomes': 1, 'sets': 4, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 2, 'cdd': 2, 'pfam': 2, 'smart': 1, 'profile': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 10368}"	"['Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers URM1 and MOCS2A. Its N-terminus first activates URM1 and MOCS2A as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 and MOCS2A to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1 and MOCS2A. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; NFS1 probably acting as a sulfur donor for thiocarboxylation reactions']"	"MOCS3"	"[{'identifier': 'GO:0008641', 'name': 'ubiquitin-like modifier activating enzyme activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016783', 'name': 'sulfurtransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0070566', 'name': 'adenylyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0002143', 'name': 'tRNA wobble position uridine thiolation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005829', 'name': 'cytosol', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A6J2MPJ1_9CHIR"	"39f3ddf73e07cf4ac3a637cab78a1f5722c60329"	True	False	False	458	"Adenylyltransferase and sulfurtransferase MOCS3"	3	"UP000504628"	"MAAKAEVRALQAEVARREKELSSLKQRLAAALLAEEEPERPAPVSPLPPKAALTREEILRYSRQLVLPELGVQGQLRLTAASVLVVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLPRQVLHGEALAGQAKVFSAAASLRSLNSAVECVPYAQALTPATALDLVRRYDVVADCSDNAPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCVFPQPPPADTVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGQLMLFDALRGRFRCIRLRSRRPDCAACGEQPTVTDLQDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGSPHVLLDVRPQVEVDICRLPHALHIPLKQLERRDAESLRLLGEAIQKGKRGTQEGAALPIYVICKLGNESQKAVKILQTLMAVQELGSLTVQDVVGGLMAWAAKIDGTFPQY"	"unreviewed"	"{'taxId': '89673', 'scientificName': 'Phyllostomus discolor', 'fullName': 'Phyllostomus discolor (pale spear-nosed bat)'}"