GET /api/protein/UniProt/A0A6J2C5P2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6J2C5P2",
"id": "A0A6J2C5P2_ZALCA",
"source_organism": {
"taxId": "9704",
"scientificName": "Zalophus californianus",
"fullName": "Zalophus californianus (California sealion)"
},
"name": "Alpha-crystallin A chain",
"description": [
"Contributes to the transparency and refractive index of the lens. Acts as a chaperone, preventing aggregation of various proteins under a wide range of stress conditions. Required for the correct formation of lens intermediate filaments as part of a complex composed of BFSP1, BFSP2 and CRYAA",
"May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions"
],
"length": 173,
"sequence": "MDIAIQHPWFKRALGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQPVFRSVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVPSGVDAGHSERAIPVSREEKPSSAPSS",
"proteome": "UP000515165",
"gene": "CRYAA",
"go_terms": [
{
"identifier": "GO:0005212",
"name": "structural constituent of eye lens",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "31f0cb0c1d6055b765001b90b1831babf04bba10",
"counters": {
"domain_architectures": 2716,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"cdd": 1,
"ssf": 1,
"pfam": 2,
"panther": 1,
"pirsf": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2716
}
}
}