"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A6J2C5P2"	"{'domain_architectures': 2490, 'entries': 14, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'cdd': 1, 'ssf': 1, 'pfam': 2, 'panther': 1, 'pirsf': 1, 'prints': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2490}"	"['Contributes to the transparency and refractive index of the lens. Acts as a chaperone, preventing aggregation of various proteins under a wide range of stress conditions. Required for the correct formation of lens intermediate filaments as part of a complex composed of BFSP1, BFSP2 and CRYAA', 'May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions']"	"CRYAA"	"[{'identifier': 'GO:0005212', 'name': 'structural constituent of eye lens', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A6J2C5P2_ZALCA"	"31f0cb0c1d6055b765001b90b1831babf04bba10"	True	False	173	"Alpha-crystallin A chain"	3	"UP000515165"	"MDIAIQHPWFKRALGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQPVFRSVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVPSGVDAGHSERAIPVSREEKPSSAPSS"	"unreviewed"	"{'taxId': '9704', 'scientificName': 'Zalophus californianus', 'fullName': 'Zalophus californianus (California sealion)'}"