HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6I9MKF6",
"id": "A0A6I9MKF6_9TELE",
"source_organism": {
"taxId": "8208",
"scientificName": "Notothenia coriiceps",
"fullName": "Notothenia coriiceps (black rockcod)"
},
"name": "Transcription factor Spi-C",
"description": [
"Controls the development of red pulp macrophages required for red blood cells recycling and iron homeostasis. Transcription factor that binds to the PU-box, a purine-rich DNA sequence (5'-GAGGA[AT]-3') that can act as a lymphoid-specific enhancer. Regulates VCAM1 gene expression"
],
"length": 270,
"sequence": "MLADLETMAYVTEIRLSAGRGAWSAAPPSSCPEVDLEVIEEYLQEHSMEVHPAHTTASPPATVSPHTHVHPHQGTRITVNSWSGKHPYEWHSHTPHEEYDEQALHPAWPSPHDNQWDHIPYSYGAPGYFDSDSLSSGSQYQEYQDSPSPLSDRGGGIERDLLPLAPLSGKRKERLFQFLFEMLQTPSMRSCIWWVQSSSGTFQFSSENKERLAQLWGKRKGNRKTMTYQKMARALRNYSRTGEIKKVKRKLTYRFDEKTLRGLQGDSHSV",
"proteome": "UP000504611",
"gene": "LOC104941552",
"go_terms": [
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0043565",
"name": "sequence-specific DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006357",
"name": "regulation of transcription by RNA polymerase II",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9be233735550f087463761b543470356402b2953",
"counters": {
"domain_architectures": 15296,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"profile": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 15296
}
}
}