General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6I8NFF9",
        "id": "A0A6I8NFF9_ORNAN",
        "source_organism": {
            "taxId": "9258",
            "scientificName": "Ornithorhynchus anatinus",
            "fullName": "Ornithorhynchus anatinus (Duckbill platypus)"
        },
        "name": "Signal transducing adaptor molecule",
        "description": [
            "Involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. May also play a role in T-cell development. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with HGS (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as a sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes"
        ],
        "length": 510,
        "sequence": "MIILLYEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMKRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVATKKEEEDLAKAIELSLKEQRQQSTTVSSLYPSTSSLLTNHHPEGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETLQGMGLFPSNFVTADLSAEPEMMKTEKKTVQFSDDIQVETIEPEPEPAYIDEDKMDQLLQMLQSADPSDDQPDIPDLLHLEAICHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQSQGYYMQSPGVSGSQVYPGQAPSGIYLVTGSAQMGSVQSYSVPPDQLSSLSHAAAPPPASSALPAQQAQASYTNPVVGSVPGNTYPNQTAIYSPPADVTAYQNAGTSMSQGPNYSLASSTPSQPRNENA",
        "proteome": "UP000002279",
        "gene": "STAM",
        "go_terms": [
            {
                "identifier": "GO:0035091",
                "name": "phosphatidylinositol binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043130",
                "name": "ubiquitin binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e0390835bbf30b88a8a62d90f55768a3fdc95672",
        "counters": {
            "domain_architectures": 2360,
            "entries": 29,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 6,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 2,
                "cathgene3d": 4,
                "cdd": 3,
                "pfam": 3,
                "ssf": 2,
                "profile": 3,
                "panther": 1,
                "prints": 2,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2360
        }
    }
}