GET /api/protein/UniProt/A0A673JFP6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A673JFP6",
"id": "A0A673JFP6_9TELE",
"source_organism": {
"taxId": "307959",
"scientificName": "Sinocyclocheilus rhinocerous",
"fullName": "Sinocyclocheilus rhinocerous"
},
"name": "Large ribosomal subunit protein uL30",
"description": [
"Component of the large ribosomal subunit. The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. Binds to G-rich structures in 28S rRNA and in mRNAs. Plays a regulatory role in the translation apparatus; inhibits cell-free translation of mRNAs"
],
"length": 207,
"sequence": "MLKITRKLIFKRAEAYHKEYRQMYRREIRMSRMARKAGNYYVPAEPKLAFVVRIRGINGVSPKVRKVLQLLRLRQIFNGVFVKLNKASINMLRIAEPYIAWGYPNLKSVRELIYKRGYGKIRKQRIPLTDNSLIEKSLGRCGIICVEDLIHEIYTVGKNFKYANNFLWPFKLSSPRGGMNKKTTHFVEGGDAGNREDQINRLVRRMN",
"proteome": "UP000472270",
"gene": "rpl7",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c584cdf392ce24e9ea441bf0e77e57c08b1dd726",
"counters": {
"domain_architectures": 7561,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7561
}
}
}