"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A673JFP6"	"{'domain_architectures': 6819, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'panther': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 6819}"	"['Component of the large ribosomal subunit. The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. Binds to G-rich structures in 28S rRNA and in mRNAs. Plays a regulatory role in the translation apparatus; inhibits cell-free translation of mRNAs']"	"rpl7"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A673JFP6_9TELE"	"c584cdf392ce24e9ea441bf0e77e57c08b1dd726"	True	False	207	"Large ribosomal subunit protein uL30"	3	"UP000472270"	"MLKITRKLIFKRAEAYHKEYRQMYRREIRMSRMARKAGNYYVPAEPKLAFVVRIRGINGVSPKVRKVLQLLRLRQIFNGVFVKLNKASINMLRIAEPYIAWGYPNLKSVRELIYKRGYGKIRKQRIPLTDNSLIEKSLGRCGIICVEDLIHEIYTVGKNFKYANNFLWPFKLSSPRGGMNKKTTHFVEGGDAGNREDQINRLVRRMN"	"unreviewed"	"{'taxId': '307959', 'scientificName': 'Sinocyclocheilus rhinocerous', 'fullName': 'Sinocyclocheilus rhinocerous'}"