General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A671SS96",
        "id": "A0A671SS96_9TELE",
        "source_organism": {
            "taxId": "1608454",
            "scientificName": "Sinocyclocheilus anshuiensis",
            "fullName": "Sinocyclocheilus anshuiensis"
        },
        "name": "Bladder cancer-associated protein",
        "description": [
            "Acts as a tumor suppressor; induces growth arrest at G(1)/S checkpoint and apoptosis via RB1-dependent and p53/TP53- and NF-kappa-B-independent mechanisms. Modulates expression of genes involved in the regulation of proliferation, cell cycle and apoptosis"
        ],
        "length": 87,
        "sequence": "MYCLQWLLPVLLIPKPLNPALWFNHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCHDSPLPDSAHDPSIVGT",
        "proteome": "UP000472260",
        "gene": "LOC107666156",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "721fecf4ba0313df4b2c46ac77c4a9e1944b208b",
        "counters": {
            "domain_architectures": 2415,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2415
        }
    }
}