"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A671SS96"	"{'domain_architectures': 2415, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'pfam': 1, 'panther': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2415}"	"['Acts as a tumor suppressor; induces growth arrest at G(1)/S checkpoint and apoptosis via RB1-dependent and p53/TP53- and NF-kappa-B-independent mechanisms. Modulates expression of genes involved in the regulation of proliferation, cell cycle and apoptosis']"	"LOC107666156"	""	"A0A671SS96_9TELE"	"721fecf4ba0313df4b2c46ac77c4a9e1944b208b"	True	False	False	87	"Bladder cancer-associated protein"	3	"UP000472260"	"MYCLQWLLPVLLIPKPLNPALWFNHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCWGNCFLYHCHDSPLPDSAHDPSIVGT"	"unreviewed"	"{'taxId': '1608454', 'scientificName': 'Sinocyclocheilus anshuiensis', 'fullName': 'Sinocyclocheilus anshuiensis'}"