GET /api/protein/UniProt/A0A671FQ60/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A671FQ60",
        "id": "A0A671FQ60_RHIFE",
        "source_organism": {
            "taxId": "59479",
            "scientificName": "Rhinolophus ferrumequinum",
            "fullName": "Rhinolophus ferrumequinum (Greater horseshoe bat)"
        },
        "name": "Acyl-coenzyme A thioesterase 8",
        "description": [
            "Catalyzes the hydrolysis of acyl-CoAs into free fatty acids and coenzyme A (CoASH), regulating their respective intracellular levels. Displays no strong substrate specificity with respect to the carboxylic acid moiety of Acyl-CoAs. Hydrolyzes medium length (C2 to C20) straight-chain, saturated and unsaturated acyl-CoAS but is inactive towards substrates with longer aliphatic chains. Moreover, it catalyzes the hydrolysis of CoA esters of bile acids, such as choloyl-CoA and chenodeoxycholoyl-CoA and competes with bile acid CoA:amino acid N-acyltransferase (BAAT). Is also able to hydrolyze CoA esters of dicarboxylic acids. It is involved in the metabolic regulation of peroxisome proliferation"
        ],
        "length": 317,
        "sequence": "MTSPQAPEDGQGSGDPSGDLRSVLVTSVLNLEPLDEDLFRGRHYWIPTTQRLFGGQIVGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKVPVLYQVERTRTGTSFSVRSVKAVQHGKPIFVCQASFQQAQPSPVQHQCSMPAVPPPEELLDHEALIAQYLRDPNLHEKYRVGLNRIAAQEVPIEIKMVNPPTLNKLQNREPNQMFWVRARGHIGEGDIKMHCCVAAYISDYAFLGTALLPHHYQHKVCFMASLDHSMWFHAPFRADHWMLYECKSPWAGGSRALVHGQLWRRDGVLAVSCSQEGVIRVKPRVSESKL",
        "proteome": "UP000472240",
        "gene": "ACOT8",
        "go_terms": [
            {
                "identifier": "GO:0047617",
                "name": "fatty acyl-CoA hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006637",
                "name": "acyl-CoA metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "21534189134aa2c19bc618fde6f3102a006e91ff",
        "counters": {
            "domain_architectures": 17805,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 2,
                "pfam": 2,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 17805
        }
    }
}