GET /api/protein/UniProt/A0A668STK2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A668STK2",
"id": "A0A668STK2_OREAU",
"source_organism": {
"taxId": "47969",
"scientificName": "Oreochromis aureus",
"fullName": "Oreochromis aureus (Israeli tilapia)"
},
"name": "Phosphoserine phosphatase",
"description": [
"Catalyzes the last irreversible step in the biosynthesis of L-serine from carbohydrates, the dephosphorylation of O-phospho-L-serine to L-serine. L-serine can then be used in protein synthesis, to produce other amino acids, in nucleotide metabolism or in glutathione synthesis, or can be racemized to D-serine, a neuromodulator. May also act on O-phospho-D-serine"
],
"length": 227,
"sequence": "MMTTLSQTKELFRRAEAVCFDVDSTVIKEEGIDELAKFCGVGDAVTEMTRKAMGGSMTFKKALTERLSIIRCSREQVNKLITDHPPQLTPGVRELVDRLHELNIKVFLISGGFRCIVEHVATQLNIPLNHVYANRLKFYFNGEYAGFDESQPTAESGGKGKVISMLKEQYGYETVVMIGDGATDLEACPPASAFIGFGGNVIRPQVKERCSWYVTSFGELLKELEKI",
"proteome": "UP000472276",
"gene": "PSPH",
"go_terms": [
{
"identifier": "GO:0036424",
"name": "L-phosphoserine phosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006564",
"name": "L-serine biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7abaa5ff36bb15cd07cb434c7298e4a841feb5fc",
"counters": {
"domain_architectures": 179620,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 1,
"cdd": 1,
"cathgene3d": 2,
"ncbifam": 2,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 179620
}
}
}