General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A668STK2",
        "id": "A0A668STK2_OREAU",
        "source_organism": {
            "taxId": "47969",
            "scientificName": "Oreochromis aureus",
            "fullName": "Oreochromis aureus (Israeli tilapia)"
        },
        "name": "Phosphoserine phosphatase",
        "description": [
            "Catalyzes the last irreversible step in the biosynthesis of L-serine from carbohydrates, the dephosphorylation of O-phospho-L-serine to L-serine. L-serine can then be used in protein synthesis, to produce other amino acids, in nucleotide metabolism or in glutathione synthesis, or can be racemized to D-serine, a neuromodulator. May also act on O-phospho-D-serine"
        ],
        "length": 227,
        "sequence": "MMTTLSQTKELFRRAEAVCFDVDSTVIKEEGIDELAKFCGVGDAVTEMTRKAMGGSMTFKKALTERLSIIRCSREQVNKLITDHPPQLTPGVRELVDRLHELNIKVFLISGGFRCIVEHVATQLNIPLNHVYANRLKFYFNGEYAGFDESQPTAESGGKGKVISMLKEQYGYETVVMIGDGATDLEACPPASAFIGFGGNVIRPQVKERCSWYVTSFGELLKELEKI",
        "proteome": "UP000472276",
        "gene": "PSPH",
        "go_terms": [
            {
                "identifier": "GO:0036424",
                "name": "L-phosphoserine phosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006564",
                "name": "L-serine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7abaa5ff36bb15cd07cb434c7298e4a841feb5fc",
        "counters": {
            "domain_architectures": 179620,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "cathgene3d": 2,
                "ncbifam": 2,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 179620
        }
    }
}