"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A668STK2"	"{'domain_architectures': 179620, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'pfam': 1, 'cdd': 1, 'cathgene3d': 2, 'ncbifam': 2, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 179620}"	"['Catalyzes the last irreversible step in the biosynthesis of L-serine from carbohydrates, the dephosphorylation of O-phospho-L-serine to L-serine. L-serine can then be used in protein synthesis, to produce other amino acids, in nucleotide metabolism or in glutathione synthesis, or can be racemized to D-serine, a neuromodulator. May also act on O-phospho-D-serine']"	"PSPH"	"[{'identifier': 'GO:0036424', 'name': 'L-phosphoserine phosphatase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006564', 'name': 'L-serine biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A668STK2_OREAU"	"7abaa5ff36bb15cd07cb434c7298e4a841feb5fc"	True	False	False	227	"Phosphoserine phosphatase"	3	"UP000472276"	"MMTTLSQTKELFRRAEAVCFDVDSTVIKEEGIDELAKFCGVGDAVTEMTRKAMGGSMTFKKALTERLSIIRCSREQVNKLITDHPPQLTPGVRELVDRLHELNIKVFLISGGFRCIVEHVATQLNIPLNHVYANRLKFYFNGEYAGFDESQPTAESGGKGKVISMLKEQYGYETVVMIGDGATDLEACPPASAFIGFGGNVIRPQVKERCSWYVTSFGELLKELEKI"	"unreviewed"	"{'taxId': '47969', 'scientificName': 'Oreochromis aureus', 'fullName': 'Oreochromis aureus (Israeli tilapia)'}"
