General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A663MS25",
        "id": "A0A663MS25_ATHCN",
        "source_organism": {
            "taxId": "194338",
            "scientificName": "Athene cunicularia",
            "fullName": "Athene cunicularia (Burrowing owl)"
        },
        "name": "DNA-directed RNA polymerase subunit",
        "description": [
            "DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III (Pol III) which synthesizes small non-coding RNAs including 5S rRNA, snRNAs, tRNAs and miRNAs from at least 500 distinct genomic loci. With CRCP/RPC9 forms a mobile stalk that protrudes from Pol III core and functions primarily in transcription initiation. Pol III plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF-kappa-B through the RIG-I pathway",
            "DNA-dependent RNA polymerase which catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates"
        ],
        "length": 206,
        "sequence": "MFVLVEMTDTVRIPPWQFQRKLNESIAEELNKKLANKVVYNVGLCICLYDITKLEDSYIFPGDGASHTKVHFRYVVFHPFLDEILIGQIKGCSQDGVHVSIGFFDDIVIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDIGEEIRFRVVDETFVDTSPTGPSSAEASTSNATEEVQKKEAPYTLVGSISEPGLGLLSWWTNS",
        "proteome": "UP000472269",
        "gene": "POLR3H",
        "go_terms": [
            {
                "identifier": "GO:0006351",
                "name": "DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003899",
                "name": "DNA-directed RNA polymerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006352",
                "name": "DNA-templated transcription initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fd05722550f5a454a1e6be8aa835c4de81dde895",
        "counters": {
            "domain_architectures": 3909,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "cdd": 1,
                "pfam": 2,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3909
        }
    }
}