"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A663MS25"	"{'domain_architectures': 3503, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'cathgene3d': 2, 'cdd': 1, 'pfam': 2, 'ncbifam': 1, 'panther': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3503}"	"['DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III (Pol III) which synthesizes small non-coding RNAs including 5S rRNA, snRNAs, tRNAs and miRNAs from at least 500 distinct genomic loci. With CRCP/RPC9 forms a mobile stalk that protrudes from Pol III core and functions primarily in transcription initiation. Pol III plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF-kappa-B through the RIG-I pathway', 'DNA-dependent RNA polymerase which catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates']"	"POLR3H"	"[{'identifier': 'GO:0006351', 'name': 'DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003899', 'name': 'DNA-directed RNA polymerase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006352', 'name': 'DNA-templated transcription initiation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A663MS25_ATHCN"	"fd05722550f5a454a1e6be8aa835c4de81dde895"	True	False	206	"DNA-directed RNA polymerase subunit"	3	"UP000472269"	"MFVLVEMTDTVRIPPWQFQRKLNESIAEELNKKLANKVVYNVGLCICLYDITKLEDSYIFPGDGASHTKVHFRYVVFHPFLDEILIGQIKGCSQDGVHVSIGFFDDIVIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDIGEEIRFRVVDETFVDTSPTGPSSAEASTSNATEEVQKKEAPYTLVGSISEPGLGLLSWWTNS"	"unreviewed"	"{'taxId': '194338', 'scientificName': 'Athene cunicularia', 'fullName': 'Athene cunicularia (Burrowing owl)'}"
