General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A663MI36",
        "id": "A0A663MI36_ATHCN",
        "source_organism": {
            "taxId": "194338",
            "scientificName": "Athene cunicularia",
            "fullName": "Athene cunicularia (Burrowing owl)"
        },
        "name": "Set1/Ash2 histone methyltransferase complex subunit ASH2",
        "description": [
            "Transcriptional regulator. Component or associated component of some histone methyltransferase complexes which regulates transcription through recruitment of those complexes to gene promoters. Component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. May play a role in hematopoiesis. In association with RBBP5 and WDR5, stimulates the histone methyltransferase activities of KMT2A, KMT2B, KMT2C, KMT2D, SETD1A and SETD1B"
        ],
        "length": 568,
        "sequence": "MVDVAAALDTESANGKDALEAAGDGSEVLDAQAGSVDEENGRQLGEIELQCGICTKWFTADTFGIDTTSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMCKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLANIGPAYDNQKQNNAVSTSGNLNGGASLGGGIAASGSGKGRGAKRKQQDGGTTGTAKKTRSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEISMDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDILGFYISLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQAPGSQIIFFKNGASQGIAFKDIFEGVYFPAISLYKGCTVSINFGPYFKYPPRDITYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP",
        "proteome": "UP000472269",
        "gene": "ASH2L",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0048188",
                "name": "Set1C/COMPASS complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "830f1293ba0349f2cfb7983c94070ba9aa3fbe10",
        "counters": {
            "domain_architectures": 1617,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 5,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 2,
                "pfam": 3,
                "ssf": 1,
                "profile": 1,
                "smart": 1,
                "panther": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1617
        }
    }
}