HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A5B8CPC3",
"id": "A0A5B8CPC3_9PROT",
"source_organism": {
"taxId": "2588534",
"scientificName": "Methylophilus medardicus",
"fullName": "Methylophilus medardicus"
},
"name": "Ribonuclease PH",
"description": [
"Phosphorolytic 3'-5' exoribonuclease that plays an important role in tRNA 3'-end maturation. Removes nucleotide residues following the 3'-CCA terminus of tRNAs; can also add nucleotides to the ends of RNA molecules by using nucleoside diphosphates as substrates, but this may not be physiologically important. Probably plays a role in initiation of 16S rRNA degradation (leading to ribosome degradation) during starvation"
],
"length": 239,
"sequence": "MTRPSQRANDQLRTIEIIRHYTKHAEGAVLIKFGDTHVICTASVEEKVPGFLKGKGQGWVTAEYGMLPRSTGSRMDREAARGKQSGRTQEIQRLIGRSLRAVIDLQKLGERTIHFDCDVIQADGGTRTASITGAYVAMVDAVGTLLQKGLLTETPITDSVAAISVGVYQGQPVLDLDYIEDSDCDTDMNVVMTGNGGFVEIQGTAEGEPFSRQTMDQMLDLAAQGIQTLAQLQTQALAT",
"proteome": "UP000311008",
"gene": "rph",
"go_terms": [
{
"identifier": "GO:0000049",
"name": "tRNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009022",
"name": "tRNA nucleotidyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008033",
"name": "tRNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2b68507c1e5f63d98cb11e53500aab413984946a",
"counters": {
"domain_architectures": 32866,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"pfam": 2,
"cdd": 1,
"cathgene3d": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"prosite": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 32866
}
}
}