GET /api/protein/UniProt/A0A5B8CPC3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A5B8CPC3",
        "id": "A0A5B8CPC3_9PROT",
        "source_organism": {
            "taxId": "2588534",
            "scientificName": "Methylophilus medardicus",
            "fullName": "Methylophilus medardicus"
        },
        "name": "Ribonuclease PH",
        "description": [
            "Phosphorolytic 3'-5' exoribonuclease that plays an important role in tRNA 3'-end maturation. Removes nucleotide residues following the 3'-CCA terminus of tRNAs; can also add nucleotides to the ends of RNA molecules by using nucleoside diphosphates as substrates, but this may not be physiologically important. Probably plays a role in initiation of 16S rRNA degradation (leading to ribosome degradation) during starvation"
        ],
        "length": 239,
        "sequence": "MTRPSQRANDQLRTIEIIRHYTKHAEGAVLIKFGDTHVICTASVEEKVPGFLKGKGQGWVTAEYGMLPRSTGSRMDREAARGKQSGRTQEIQRLIGRSLRAVIDLQKLGERTIHFDCDVIQADGGTRTASITGAYVAMVDAVGTLLQKGLLTETPITDSVAAISVGVYQGQPVLDLDYIEDSDCDTDMNVVMTGNGGFVEIQGTAEGEPFSRQTMDQMLDLAAQGIQTLAQLQTQALAT",
        "proteome": "UP000311008",
        "gene": "rph",
        "go_terms": [
            {
                "identifier": "GO:0000049",
                "name": "tRNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009022",
                "name": "tRNA nucleotidyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008033",
                "name": "tRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2b68507c1e5f63d98cb11e53500aab413984946a",
        "counters": {
            "domain_architectures": 32866,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "pfam": 2,
                "cdd": 1,
                "cathgene3d": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "prosite": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32866
        }
    }
}