"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A5B8CPC3"	"{'domain_architectures': 32866, 'entries': 18, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'pfam': 2, 'cdd': 1, 'cathgene3d': 1, 'panther': 1, 'ncbifam': 1, 'hamap': 1, 'prosite': 1, 'interpro': 8}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 32866}"	"[""Phosphorolytic 3'-5' exoribonuclease that plays an important role in tRNA 3'-end maturation. Removes nucleotide residues following the 3'-CCA terminus of tRNAs; can also add nucleotides to the ends of RNA molecules by using nucleoside diphosphates as substrates, but this may not be physiologically important. Probably plays a role in initiation of 16S rRNA degradation (leading to ribosome degradation) during starvation""]"	"rph"	"[{'identifier': 'GO:0000049', 'name': 'tRNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009022', 'name': 'tRNA nucleotidyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008033', 'name': 'tRNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A5B8CPC3_9PROT"	"2b68507c1e5f63d98cb11e53500aab413984946a"	True	False	False	239	"Ribonuclease PH"	3	"UP000311008"	"MTRPSQRANDQLRTIEIIRHYTKHAEGAVLIKFGDTHVICTASVEEKVPGFLKGKGQGWVTAEYGMLPRSTGSRMDREAARGKQSGRTQEIQRLIGRSLRAVIDLQKLGERTIHFDCDVIQADGGTRTASITGAYVAMVDAVGTLLQKGLLTETPITDSVAAISVGVYQGQPVLDLDYIEDSDCDTDMNVVMTGNGGFVEIQGTAEGEPFSRQTMDQMLDLAAQGIQTLAQLQTQALAT"	"unreviewed"	"{'taxId': '2588534', 'scientificName': 'Methylophilus medardicus', 'fullName': 'Methylophilus medardicus'}"
