HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A452R3X1",
"id": "A0A452R3X1_URSAM",
"source_organism": {
"taxId": "9643",
"scientificName": "Ursus americanus",
"fullName": "Ursus americanus (American black bear)"
},
"name": "DNA repair nuclease/redox regulator APEX1",
"description": [
"Initiates repair of AP sites in DNA by catalyzing hydrolytic incision of the phosphodiester backbone immediately adjacent to the damage, generating a single-strand break with 5'-deoxyribose phosphate and 3'-hydroxyl ends"
],
"length": 318,
"sequence": "MPKRGKKGAVAEDGEEPKIEPEAKKSKAGTKKNEKEAAGEGPVLYEDPPDQKTAPSGKSATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELSGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDAFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTAYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL",
"proteome": "UP000291022",
"gene": "APEX1",
"go_terms": [
{
"identifier": "GO:0004518",
"name": "nuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006281",
"name": "DNA repair",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004519",
"name": "endonuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "01d417aef5428373d5752df5b6a37440f3868628",
"counters": {
"domain_architectures": 156843,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"profile": 1,
"pfam": 1,
"panther": 1,
"ncbifam": 2,
"prosite": 3,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 156843
}
}
}