GET /api/protein/UniProt/A0A3Q7MX32/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3Q7MX32",
        "id": "A0A3Q7MX32_CALUR",
        "source_organism": {
            "taxId": "34884",
            "scientificName": "Callorhinus ursinus",
            "fullName": "Callorhinus ursinus (Northern fur seal)"
        },
        "name": "2-amino-3-carboxymuconate-6-semialdehyde decarboxylase",
        "description": [
            "Converts alpha-amino-beta-carboxymuconate-epsilon-semialdehyde (ACMS) to alpha-aminomuconate semialdehyde (AMS). ACMS can be converted non-enzymatically to quinolate (QA), a key precursor of NAD, and a potent endogenous excitotoxin of neuronal cells which is implicated in the pathogenesis of various neurodegenerative disorders. In the presence of ACMSD, ACMS is converted to AMS, a benign catabolite. ACMSD ultimately controls the metabolic fate of tryptophan catabolism along the kynurenine pathway"
        ],
        "length": 278,
        "sequence": "MGRSSEWSKRTAGIQKSVLEKWTKQAKPQDTLDLCQLLNNDLAATVANHPRRFIGLGTLPMQAPELAVKEMERCVKELGFPGVQIGSHINEWNLNAPELFPVYAVAEKLNCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTTAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFNMRPDLCAQDNPTNPKKYLGSFYTDSLVHDPLALKLLTDVIGKDQVILGTDYPFPLGELEPGKLIESIEEFDAETKDKLKAGNALAFLGLERKQFE",
        "proteome": "UP000286641",
        "gene": "ACMSD",
        "go_terms": [
            {
                "identifier": "GO:0016787",
                "name": "hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016831",
                "name": "carboxy-lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "893f5bb5f82dba8c120faf41d4a977fe8fba5622",
        "counters": {
            "domain_architectures": 79182,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 79182
        }
    }
}