General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3Q2X608",
        "id": "A0A3Q2X608_HAPBU",
        "source_organism": {
            "taxId": "8153",
            "scientificName": "Haplochromis burtoni",
            "fullName": "Haplochromis burtoni (Burton's mouthbrooder)"
        },
        "name": "Collectin-11",
        "description": [
            "Lectin that plays a role in innate immunity, apoptosis and embryogenesis. Calcium-dependent lectin that binds self and non-self glycoproteins presenting high mannose oligosaccharides with at least one terminal alpha-1,2-linked mannose epitope. Primarily recognizes the terminal disaccharide of the glycan. Also recognizes a subset of fucosylated glycans and lipopolysaccharides. Plays a role in innate immunity through its ability to bind non-self sugars presented by microorganisms and to activate the complement through the recruitment of MAPS1. Also plays a role in apoptosis through its ability to bind in a calcium-independent manner the DNA present at the surface of apoptotic cells and to activate the complement in response to this binding. Finally, plays a role in development, probably serving as a guidance cue during the migration of neural crest cells and other cell types during embryogenesis"
        ],
        "length": 279,
        "sequence": "MTGEKLLLPMILMSVVMSLLPMQTSYGQHLPEESCTVQILVPGLKGEPGEKGQKGAPGRPGRVGPPGETGPPGVKGHKGIMGRYGKVGPSGMKGSKGDPGDPGTRGPDGEPGVPCECAPIRRMIGEMDILVAQLSSELKFIKNALPSPAAVAGIKETDSKVYLLVKEAKRYTEAEGYCQTRGGHLVMPKDEGANAAIAGYITDAGLSRVYIGIHDLEREGVFTYVDHSPMTTFSKWRKGEPNNAYDDEDCAEMVTSGEWTDVACHPTMYFVCEFDKDNI",
        "proteome": "UP000264840",
        "gene": null,
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b625bbf60511957b4004441b636cccc6a6bd9776",
        "counters": {
            "domain_architectures": 2652,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 1,
                "smart": 1,
                "ssf": 1,
                "profile": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2652
        }
    }
}