"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A3Q2X608"	"{'domain_architectures': 2652, 'entries': 14, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'cathgene3d': 1, 'smart': 1, 'ssf': 1, 'profile': 1, 'cdd': 1, 'panther': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2652}"	"['Lectin that plays a role in innate immunity, apoptosis and embryogenesis. Calcium-dependent lectin that binds self and non-self glycoproteins presenting high mannose oligosaccharides with at least one terminal alpha-1,2-linked mannose epitope. Primarily recognizes the terminal disaccharide of the glycan. Also recognizes a subset of fucosylated glycans and lipopolysaccharides. Plays a role in innate immunity through its ability to bind non-self sugars presented by microorganisms and to activate the complement through the recruitment of MAPS1. Also plays a role in apoptosis through its ability to bind in a calcium-independent manner the DNA present at the surface of apoptotic cells and to activate the complement in response to this binding. Finally, plays a role in development, probably serving as a guidance cue during the migration of neural crest cells and other cell types during embryogenesis']"	""	""	"A0A3Q2X608_HAPBU"	"b625bbf60511957b4004441b636cccc6a6bd9776"	True	False	False	279	"Collectin-11"	3	"UP000264840"	"MTGEKLLLPMILMSVVMSLLPMQTSYGQHLPEESCTVQILVPGLKGEPGEKGQKGAPGRPGRVGPPGETGPPGVKGHKGIMGRYGKVGPSGMKGSKGDPGDPGTRGPDGEPGVPCECAPIRRMIGEMDILVAQLSSELKFIKNALPSPAAVAGIKETDSKVYLLVKEAKRYTEAEGYCQTRGGHLVMPKDEGANAAIAGYITDAGLSRVYIGIHDLEREGVFTYVDHSPMTTFSKWRKGEPNNAYDDEDCAEMVTSGEWTDVACHPTMYFVCEFDKDNI"	"unreviewed"	"{'taxId': '8153', 'scientificName': 'Haplochromis burtoni', 'fullName': ""Haplochromis burtoni (Burton's mouthbrooder)""}"